- Xrn1 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-89419
- Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: NVASSVLGKS VFVNWPHLEE ARVVAVSDGE TKFYLEEPPG TQKLYSGRTA PPSKVVHLGD KEQSNWAKEV QGISEHYLRR K
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- SEP1
- Xrn1
- Unconjugated
- Human
- 5'-3' exoribonuclease 1
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Cell Cycle and Replication
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
NVASSVLGKSVFVNWPHLEEARVVAVSDGETKFYLEEPPGTQKLYSGRTAPPSKVVHLGDKEQSNWAKEVQGISEHYLRRK
Specifications/Features
Available conjugates: Unconjugated